PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ONIVA04G12010.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MIKC_MADS
Protein Properties Length: 204aa    MW: 23545.3 Da    PI: 8.052
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ONIVA04G12010.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF79.42.5e-251058250
                     ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
           SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                     rien   rqvtf+kRr g+lKKA+ELSvLCda++ vi+fs++gk+ye +
  ONIVA04G12010.1 10 RIENPVHRQVTFCKRRMGLLKKAKELSVLCDADIGVIVFSPHGKIYELA 58
                     8*********************************************965 PP

2K-box60.28.4e-2180174598
            K-box   5 sgksleeakaeslqqelakLkkeienLqreqRhllGe.dLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkk 97 
                      + +s+e++  +  qq++  L++e++ Lq+++R + Ge d++ ++l eLq+Le++Le  +++iRs+K++l+ ++ie l++ke  l+ +n  L+++
  ONIVA04G12010.1  80 QAESNEQNIPQVIQQDVLLLRQEVDLLQNSLRYMYGErDISHMNLGELQSLESNLEVWVNNIRSTKMQLMSREIEMLKNKEGILKAANDILQER 173
                      4555777788999***********************978****************************************************998 PP

            K-box  98 l 98 
                      +
  ONIVA04G12010.1 174 I 174
                      7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004323.3E-35160IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.01E-28177IPR002100Transcription factor, MADS-box
PROSITE profilePS5006629.24161IPR002100Transcription factor, MADS-box
CDDcd002651.89E-38275No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004043.5E-26323IPR002100Transcription factor, MADS-box
PfamPF003194.4E-241056IPR002100Transcription factor, MADS-box
PRINTSPR004043.5E-262338IPR002100Transcription factor, MADS-box
PRINTSPR004043.5E-263859IPR002100Transcription factor, MADS-box
PfamPF014861.3E-2383174IPR002487Transcription factor, K-box
PROSITE profilePS5129713.34489181IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 204 aa     Download sequence    Send to blast
MARGKVQMRR IENPVHRQVT FCKRRMGLLK KAKELSVLCD ADIGVIVFSP HGKIYELATN  60
GNMQGLIERY KNKSNLPEAQ AESNEQNIPQ VIQQDVLLLR QEVDLLQNSL RYMYGERDIS  120
HMNLGELQSL ESNLEVWVNN IRSTKMQLMS REIEMLKNKE GILKAANDIL QERIIAQTSI  180
MDVGCNMMIP QVPFQLTTES NYYF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_S8e-15184183Myocyte-specific enhancer factor 2B
1tqe_R8e-15184183Myocyte-specific enhancer factor 2B
1tqe_Q8e-15184183Myocyte-specific enhancer factor 2B
1tqe_P8e-15184183Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001288322.11e-115MADS-box transcription factor 26-like
SwissprotA2YQK95e-78MAD26_ORYSI; MADS-box transcription factor 26
SwissprotQ0J8G85e-78MAD26_ORYSJ; MADS-box transcription factor 26
TrEMBLA0A0E0H1C01e-150A0A0E0H1C0_ORYNI; Uncharacterized protein
TrEMBLA2XTV61e-150A2XTV6_ORYSI; Putative uncharacterized protein
STRINGBGIOSGA015021-PA1e-150(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP149136112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G71692.12e-58AGAMOUS-like 12